MCMCB Pro
S37.99

S37.99Other injury of unspecified urinary and pelvic organ

Non-billable headerICD-10-CM

S37.99 is a non-billable header ICD-10-CM code for other injury of unspecified urinary and pelvic organ. It cannot be billed on its own: choose one of the more specific child codes below. This code also requires a 7th character before it is complete.

This code requires a 7th character

The appropriate 7th character is to be added to each code from category S37

A
initial encounter
D
subsequent encounter
S
sequela

Risk adjustment

S37.99 does not map to an HCC and does not risk-adjust under CMS-HCC V28. That is normal — most ICD-10 codes do not. It still needs to be coded correctly; it just will not move a RAF score.

How S37.99 is indexed

Coders do not find codes by browsing the tabular list — they look them up in the alphabetic index, under the word the physician wrote. These are the index entries that lead here, so you can see which chart wordings map to S37.99.

  • Perforation, perforatedpelvicorgan
  • Injuryurinary organspecifiedtype NEC
  • Injurypelvis, pelvicorganspecifiedtype NEC
  • Injuryintra-abdominalspecifiedpelvicspecifiedtype NEC

Code history

S37.99 has not changed since FY2024 — no addition, revision or deletion across the three most recent ICD-10-CM releases.

Code to one of these instead S37.99

3 child codes. Green means billable.

Related codes at this level

Codes that share S37.9. If S37.99 is not quite right, the correct code is usually one of these.

Questions about S37.99

Is S37.99 a billable ICD-10-CM code?
No. S37.99 is a non-billable header code. Code to a higher level of specificity using one of its child codes.
Where does S37.99 sit in the tabular list?
Injury, poisoning and certain other consequences of external causes (S00-T88), in the block Injuries to the abdomen, lower back, lumbar spine, pelvis and external genitals (S30-S39).
ICD-10-CMFY2026-Apr· effective April 1, 2026

Loaded directly from the CMS/NCHS ICD-10-CM public-domain release — see data sources and our editorial policy. If this page disagrees with the CMS tabular list, this page is wrong. Reference information for professional coders; not medical or billing advice.